PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g53010.1.p
Common NameBRADI_2g53010, LOC100826013
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 557aa    MW: 60172.7 Da    PI: 4.6801
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g53010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.1e-164289148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT  Ed +lvd+vk++G g+W+++ +  g+ R++k+c++rw ++l
  Bradi2g53010.1.p 42 KGPWTSAEDAILVDYVKKHGEGNWNAVQKNTGLFRCGKSCRLRWANHL 89
                      79******************************************9986 PP

2Myb_DNA-binding521.7e-1695138146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +g++T+eE+ l+++++ ++G++ W++ a++++ gRt++++k++w++
  Bradi2g53010.1.p  95 KGAFTPEEERLIIQLHSKMGNK-WARMAAHLP-GRTDNEIKNYWNT 138
                       799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0016936.3E-2531556IPR016310Transcription factor, GAMYB
PROSITE profilePS5129416.6253789IPR017930Myb domain
SuperFamilySSF466893.74E-3139136IPR009057Homeodomain-like
SMARTSM007172.1E-144191IPR001005SANT/Myb domain
PfamPF002491.1E-144289IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-234396IPR009057Homeodomain-like
CDDcd001672.71E-114489No hitNo description
PROSITE profilePS5129425.48290144IPR017930Myb domain
SMARTSM007173.4E-1794142IPR001005SANT/Myb domain
PfamPF002491.3E-1595138IPR001005SANT/Myb domain
CDDcd001671.26E-1297138No hitNo description
Gene3DG3DSA:1.10.10.604.8E-2697142IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MYRVKSESDC EMMHQDQMDS PVADDGSSGG SPHRGSGPPL KKGPWTSAED AILVDYVKKH  60
GEGNWNAVQK NTGLFRCGKS CRLRWANHLR PNLKKGAFTP EEERLIIQLH SKMGNKWARM  120
AAHLPGRTDN EIKNYWNTRI KRCQRAGLPI YPASICNQSA NEDQQGSSDF NCGDNISSDL  180
LNGNGLYLPD FTCDNFIGNS EALSYAPQLS AVSISNLLGQ SFASKNCGFM DQVNQAGMLK  240
QSDGLLPGLS DTINGTLSSV DQFSNDSQKL KQTLGFDYLH EANSSSKIVA PFFEGALTGS  300
HAFLNGNFST SRATNGPLKM ELPSLQDTES DPNSWLKYTV APAMQPTELI DPYLQSPTTT  360
PSVKSECASP SRNSGLLEEV LGAEVLRSGK NQQQSVRSSS SSVSTPCDTT VGCPEFDLCQ  420
EYWEEHGSTY LSEYAPFSGN SLTEPTAPVS AASPDVFQLS KISPAQSPSL GSGEQEMQPA  480
YEPGAGDASP YPEIFRPDAL FSGNTAGSSV FNNAIAMLLG NDMNIECKSV LGDGTVFDPS  540
SWSNMPHACQ MSEEFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-33381423106B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564452.10.0PREDICTED: transcription factor GAMYB-like
SwissprotA2WW870.0GAM1_ORYSI; Transcription factor GAMYB
TrEMBLI1HSP40.0I1HSP4_BRADI; Uncharacterized protein
STRINGBRADI2G53010.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39473664
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.19e-83myb domain protein 33